📓 Download this page as a Jupyter notebook

Natural variants

UniProt records naturally occurring sequence variation — differences between individuals, disease-associated mutations, polymorphisms — as up:Natural_Variant_Annotation resources attached to a protein via up:annotation. Each one carries a free-text rdfs:comment describing the variant, and, where known, the exact sequence position and amino acid substitution involved.

These queries are adapted from the SIB SPARQL examples collection for UniProt.

Example data (Turtle) — edit it, then re-run any query below
base <http://purl.uniprot.org/uniprot/>
prefix up: <http://purl.uniprot.org/core/>
prefix rdf: <http://www.w3.org/1999/02/22-rdf-syntax-ns#>
prefix rdfs: <http://www.w3.org/2000/01/rdf-schema#>
prefix taxon: <http://purl.uniprot.org/taxonomy/>
prefix faldo: <http://biohackathon.org/resource/faldo#>
prefix isoform: <http://purl.uniprot.org/isoforms/>
prefix citation: <http://purl.uniprot.org/citations/>

<P37840> a up:Protein ;
  up:organism taxon:9606 ;
  up:sequence isoform:P37840-1 ;
  up:annotation <P37840#VAR_001>, <P37840#VAR_002>, <P37840#VAR_003> .

isoform:P37840-1 a up:Simple_Sequence ;
  rdf:value "YTKAGVEQAVAAALPKAVVEQTAKAVVEQAA" .

<P37840#VAR_001> a up:Natural_Variant_Annotation ;
  rdfs:comment "In PARK4; dementia with Lewy bodies; leads to a loss of function" .

<P37840#VAR_002> a up:Natural_Variant_Annotation ;
  rdfs:comment "Found in a patient with Parkinson disease" ;
  up:substitution "F" ;
  up:range [
    faldo:begin [ faldo:position 1 ; faldo:reference isoform:P37840-1 ] ;
    faldo:end [ faldo:position 1 ; faldo:reference isoform:P37840-1 ]
  ] .

<P37840#VAR_003> a up:Natural_Variant_Annotation ;
  rdfs:comment "Rare" .

[] rdf:object <P37840#VAR_003> ;
   up:attribution <P37840#VAR_003_attribution> .

<P37840#VAR_003_attribution> up:source citation:9812111 .

citation:9812111 a up:Journal_Citation .

Variants matching a keyword

Select all human UniProtKB entries with a sequence variant whose description contains a given word — here, "loss of function".

PREFIX rdfs: <http://www.w3.org/2000/01/rdf-schema#>
PREFIX taxon: <http://purl.uniprot.org/taxonomy/>
PREFIX up: <http://purl.uniprot.org/core/>

SELECT ?protein ?text
WHERE
{
        ?protein a up:Protein .
        ?protein up:organism taxon:9606 .
        ?protein up:annotation ?annotation .
        ?annotation a up:Natural_Variant_Annotation .
        ?annotation rdfs:comment ?text .
        FILTER (CONTAINS(?text, 'loss of function'))
}

Variants at a specific position in the sequence

This one is more involved: it walks from the variant annotation to its up:range, from there to the FALDO faldo:begin position, reads the reference sequence’s actual value with rdf:value, and uses SUBSTR to pull out the single amino acid at that position — then filters for variants that change a tyrosine (Y) to a phenylalanine (F).

PREFIX faldo: <http://biohackathon.org/resource/faldo#>
PREFIX rdf: <http://www.w3.org/1999/02/22-rdf-syntax-ns#>
PREFIX rdfs: <http://www.w3.org/2000/01/rdf-schema#>
PREFIX taxon: <http://purl.uniprot.org/taxonomy/>
PREFIX up: <http://purl.uniprot.org/core/>

SELECT ?protein ?annotation ?begin ?text
WHERE
{
        ?protein a up:Protein ;
            up:organism taxon:9606 ;
            up:annotation ?annotation .
        ?annotation a up:Natural_Variant_Annotation ;
            rdfs:comment ?text ;
            up:substitution ?substitution ;
            up:range/faldo:begin
                [ faldo:position ?begin ;
                  faldo:reference ?sequence ] .
        ?sequence rdf:value ?value .
        BIND (substr(?value, ?begin, 1) as ?original) .
        FILTER(?original = 'Y' && ?substitution = 'F') .
}

Variants backed by a literature reference

Adapted from sparql-examples UniProt/19.

UniProt attaches evidence to many annotations by reifying the up:annotation statement (rdf:object points at the annotation) and hanging an up:attribution off that reified statement, which in turn points to its up:source - here in this specific case a up:Journal_Citation.

PREFIX rdf: <http://www.w3.org/1999/02/22-rdf-syntax-ns#>
PREFIX up: <http://purl.uniprot.org/core/>

SELECT
    ?accession
    ?annotation_acc
    ?pubmed
WHERE
{
        ?protein a up:Protein ;
            up:annotation ?annotation .
        ?annotation a up:Natural_Variant_Annotation .
        ?linkToEvidence rdf:object ?annotation ;
                        up:attribution ?attribution .
        ?attribution up:source ?source .
        ?source a up:Journal_Citation .
  BIND(SUBSTR(STR(?protein),33) AS ?accession)
  BIND(IF(CONTAINS(STR(?annotation), "#SIP"), SUBSTR(STR(?annotation),33), SUBSTR(STR(?annotation),36))AS?annotation_acc)
  BIND(SUBSTR(STR(?source),35) AS ?pubmed)
}

The variant with the longest description

A simple sort: order every natural variant annotation by the length of its comment, longest first.

PREFIX rdfs: <http://www.w3.org/2000/01/rdf-schema#>
PREFIX up: <http://purl.uniprot.org/core/>

SELECT
    ?annotation ?comment
WHERE {
    ?annotation a up:Natural_Variant_Annotation ;
        rdfs:comment ?comment .
}
ORDER BY DESC(STRLEN(?comment))